Aeromonas sp. ASNIH5: C2U30_04475 Help Entry C2U30_04475       CDS       T05873                                  Name (GenBank) DinI family protein   KO K12149   DNA-damage-inducible protein I Organism aes  Aeromonas sp. ASNIH5 Brite KEGG Orthology (KO) [BR:aes00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:aes03400]     C2U30_04475 DNA repair and recombination proteins [BR:aes03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     C2U30_04475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI MinE Motif Other DBs NCBI-ProteinID:  AUT41018 LinkDB All DBs Position complement(1009431..1009685) Genome browser AA seq 84 aa AA seqDB search MRLEIIIDRKHQIPTSTMEALRQELLKQLGERFPDLHVRVAPGSAMALTVSRASKEDKEL AEAMVQEVWENADSWMPEEEALEA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcgcctggaaatcatcatcgacagaaaacaccagatccccacctcgaccatggaggcc ttgcgccaggagctgctcaagcaactgggtgagcgctttcccgatctgcatgtgcgggtg gcaccgggtagtgccatggctctgacggtcagtcgcgccagcaaggaagacaaggagctg gccgaagccatggtgcaggaggtgtgggaaaacgccgatagctggatgccggaggaagag gctctggaggcctga

DBGET integrated database retrieval system