Aestuariibaculum sp. YM273: RBH94_11915 Help Entry RBH94_11915       CDS       T09314                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism aest  Aestuariibaculum sp. YM273 Brite KEGG Orthology (KO) [BR:aest00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:aest03032]     RBH94_11915    03036 Chromosome and associated proteins [BR:aest03036]     RBH94_11915    03400 DNA repair and recombination proteins [BR:aest03400]     RBH94_11915 DNA replication proteins [BR:aest03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     RBH94_11915 Chromosome and associated proteins [BR:aest03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     RBH94_11915 DNA repair and recombination proteins [BR:aest03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       RBH94_11915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-DNA_bdg 2-Hacid_dh Motif Other DBs NCBI-ProteinID:  WMI64765 LinkDB All DBs Position 2771743..2772015 Genome browser AA seq 90 aa AA seqDB search MNKTDLIDAMAEHAGITKAAAKKALECALIEIEGALQKGNRVSLVGFGSWSVSKRAAREG RNPQTGETIKIKAKNIVKFKAGSDLSDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagatttaatcgatgcgatggcagaacatgctggaattactaaggctgca gcaaaaaaggctttagaatgtgcactaattgaaattgaaggagctttacaaaaaggtaac agagtttctttagtaggatttggttcttggtcagtttcgaaaagagcagctagagaaggt agaaacccacaaactggagagactatcaaaatcaaagctaaaaacattgtaaagtttaaa gctggttcagatttatcagacgcagtaaactaa

DBGET integrated database retrieval system