Actinobacillus equuli subsp. equuli: ACEE_04020 Help Entry ACEE_04020        CDS       T03501                                  Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism aeu  Actinobacillus equuli subsp. equuli Brite KEGG Orthology (KO) [BR:aeu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aeu03036]     ACEE_04020 Chromosome and associated proteins [BR:aeu03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     ACEE_04020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB YabA DUF7491 GAS DUF2968 Dynamin-like_hel_bact NPV_P10 DUF3450 APG6_N Phage_GPO COG3_N FlaC_arch Cep57_CLD_2 EzrA ERM_helical Cluap1 WXG100 DLP_helical OVT1 K-box ATG14 SKA2 Tropomyosin Prominin Muted Occludin_ELL DUF1664 Mis12 DUF5063 Herpes_UL6 TMF_DNA_bd DIMCO_N GrpE Spc7 bZIP_1 ADIP DUF16 DUF2203 Nup54 UPF0242 SbcD_C YlqD DUF745 Macoilin ZYG-11_interact PCRF FapA V_ATPase_I TSC22 OmpH Motif Other DBs NCBI-ProteinID:  AIZ78948 UniProt:  A0A0A7MER8 LinkDB All DBs Position 848609..848827 Genome browser AA seq 72 aa AA seqDB search MSLSILDQLEEKIKQAVETIQLLQLEVEELKEKNNTVEQEKETLRQEFEQLKSEQQSFQD RLRSLLGQIDNV NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgtcattatcaattcttgaccaacttgaagaaaaaattaaacaagcagtagaaacaatt caattacttcaattagaagtagaagaattaaaagaaaagaacaatactgtagagcaagaa aaagaaacattacgccaagaatttgaacaattaaaatctgagcaacaaagcttccaagat cgtttacgttcacttttaggtcaaatcgacaacgtataa

DBGET integrated database retrieval system