Actinidia eriantha (wild kiwifruit): 130755837 Help Entry 130755837         CDS       T09464                                  Name (RefSeq) protein MHF2 homolog isoform X1   KO K15360   centromere protein X Organism aew  Actinidia eriantha (wild kiwifruit) Pathway aew03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:aew00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     130755837  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:aew03400]     130755837 DNA repair and recombination proteins [BR:aew03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      130755837 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X Motif Other DBs NCBI-GeneID:  130755837 NCBI-ProteinID:  XP_057466365 LinkDB All DBs Position 19:complement(23048266..23051834) Genome browser AA seq 113 aa AA seqDB search MCVRARAHLSENCLCKSQDLIHAIFKLVWNRKPIQREKNEGTEALEGETGAGTSKKSRPT FANANALKMSCELLRVFITEAIERAATIAEAEGVSKIEPTHLERILPQLLLDF NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgtgtgtgcgcgcgcgcgcgcatttatctgaaaattgtttatgtaaatcgcaggatctg attcatgcaatcttcaagctcgtatggaaccgtaaacctatccagcgcgagaaaaatgaa ggcactgaggctttggaaggagagacaggagctggaacatccaagaaaagtcgtcctacc tttgctaatgcaaatgctttgaagatgagctgtgaacttcttcgagtctttatcacagag gcaattgaacgtgctgctacgattgctgaagcagagggtgttagtaaaatagagccaact catctggaaaggattcttccacagttacttttagatttttaa

DBGET integrated database retrieval system