Actinidia eriantha (wild kiwifruit): 130761340 Help Entry 130761340         CDS       T09464                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism aew  Actinidia eriantha (wild kiwifruit) Pathway aew03018   RNA degradation aew03040   Spliceosome Brite KEGG Orthology (KO) [BR:aew00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     130761340   09123 Folding, sorting and degradation    03018 RNA degradation     130761340  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:aew03019]     130761340    03041 Spliceosome [BR:aew03041]     130761340 Messenger RNA biogenesis [BR:aew03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      130761340   mRNA degradation factors    5'-3' decay     Lsm complex      130761340 Spliceosome [BR:aew03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     130761340  Complex C   U2 snRNP components     130761340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM SM-ATX DUF150_C DUF1256 Motif Other DBs NCBI-GeneID:  130761340 NCBI-ProteinID:  XP_057472808 LinkDB All DBs Position 23:1157855..1160674 Genome browser AA seq 93 aa AA seqDB search MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FIRGSVVRYVQLPPDGVDIELLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttgttcttctcgtatttcaaggacctagtgggcagagaagtgactgttgagttaaag aacgatctagccatccgaggcactctacattcggttgaccagtatctcaatattaagctt gagaacactagggttgtggatcaagacaagtatccccacatgctctctgtaaggaactgc ttcatcagaggatcagtggttcgatatgttcagttacctccggatggtgtcgacattgaa ctgctgcatgatgccaccagaagagaagctcgtggagggtga

DBGET integrated database retrieval system