Actinidia eriantha (wild kiwifruit): 130767849 Help Entry 130767849         CDS       T09464                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism aew  Actinidia eriantha (wild kiwifruit) Pathway aew04145   Phagosome aew04148   Efferocytosis aew04517   IgSF CAM signaling aew04518   Integrin signaling aew04620   Toll-like receptor signaling pathway aew05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:aew00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     130767849    04518 Integrin signaling     130767849  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     130767849    04148 Efferocytosis     130767849  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     130767849  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     130767849  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aew04131]     130767849   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aew04147]     130767849    04031 GTP-binding proteins [BR:aew04031]     130767849 Membrane trafficking [BR:aew04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     130767849  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     130767849   Macropinocytosis    Ras GTPases     130767849  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     130767849 Exosome [BR:aew04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130767849   Exosomal proteins of other body fluids (saliva and urine)    130767849   Exosomal proteins of colorectal cancer cells    130767849   Exosomal proteins of bladder cancer cells    130767849 GTP-binding proteins [BR:aew04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     130767849 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  130767849 NCBI-ProteinID:  XP_057480873 LinkDB All DBs Position 26:12403808..12411187 Genome browser AA seq 205 aa AA seqDB search MASRFINCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDT AGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENILKKWIPELQHFAPGIPVVLVGTKLD LREDKHYLADHPGLVTVSTAQGEELRKQIGASYFIECSSKTQQNVKAVFDATIKIVIKPP QKQKEKKKKQRRGCLICGTNLVCLK NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcttcaaggttcatcaattgtgtaacagttggtgatggggctgttggcaaaacttgt atgcttatttgctataccagtaacaaattccccactgactatataccaactgtgtttgac aacttcagtgcaaatgtagtagtagaaggcaccactgtcaatttaggcctctgggacaca gctgggcaagaggattacaatagattaaggcccttgagctatcgaggggcggatgtgttt gtcttagctttctcactagttagtcgcgcaagctacgagaacatactcaaaaagtggatc cctgaacttcagcattttgcccctggaattccggtagtactggttggcaccaaattggac cttcgtgaggacaagcactatttggctgatcatcctgggctggtgactgtatccactgca cagggagaggagctacgtaaacagataggggcctcatattttattgagtgcagctctaaa actcaacagaatgtgaaagcagtttttgatgctacaatcaagatagttatcaaaccacca caaaaacagaaggagaagaagaaaaaacaacgtcgaggatgtctaatatgtgggacgaac cttgtgtgtctgaaatga

DBGET integrated database retrieval system