Actinidia eriantha (wild kiwifruit): 130767849 Help Entry 130767849         CDS       T09464                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism aew  Actinidia eriantha (wild kiwifruit) Pathway aew04145   Phagosome aew04148   Efferocytosis aew04620   Toll-like receptor signaling pathway aew05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:aew00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     130767849    04148 Efferocytosis     130767849  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     130767849  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     130767849  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aew04131]     130767849   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aew04147]     130767849    04031 GTP-binding proteins [BR:aew04031]     130767849 Membrane trafficking [BR:aew04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     130767849  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     130767849   Macropinocytosis    Ras GTPases     130767849  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     130767849 Exosome [BR:aew04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130767849   Exosomal proteins of other body fluids (saliva and urine)    130767849   Exosomal proteins of colorectal cancer cells    130767849   Exosomal proteins of bladder cancer cells    130767849 GTP-binding proteins [BR:aew04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     130767849 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  130767849 NCBI-ProteinID:  XP_057480873 LinkDB All DBs Position 26:12403808..12411187 Genome browser AA seq 205 aa AA seqDB search MASRFINCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGLWDT AGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENILKKWIPELQHFAPGIPVVLVGTKLD LREDKHYLADHPGLVTVSTAQGEELRKQIGASYFIECSSKTQQNVKAVFDATIKIVIKPP QKQKEKKKKQRRGCLICGTNLVCLK NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcttcaaggttcatcaattgtgtaacagttggtgatggggctgttggcaaaacttgt atgcttatttgctataccagtaacaaattccccactgactatataccaactgtgtttgac aacttcagtgcaaatgtagtagtagaaggcaccactgtcaatttaggcctctgggacaca gctgggcaagaggattacaatagattaaggcccttgagctatcgaggggcggatgtgttt gtcttagctttctcactagttagtcgcgcaagctacgagaacatactcaaaaagtggatc cctgaacttcagcattttgcccctggaattccggtagtactggttggcaccaaattggac cttcgtgaggacaagcactatttggctgatcatcctgggctggtgactgtatccactgca cagggagaggagctacgtaaacagataggggcctcatattttattgagtgcagctctaaa actcaacagaatgtgaaagcagtttttgatgctacaatcaagatagttatcaaaccacca caaaaacagaaggagaagaagaaaaaacaacgtcgaggatgtctaatatgtgggacgaac cttgtgtgtctgaaatga

DBGET integrated database retrieval system