Actinidia eriantha (wild kiwifruit): 130770313 Help Entry 130770313         CDS       T09464                                  Name (RefSeq) calmodulin-7   KO K02183   calmodulin Organism aew  Actinidia eriantha (wild kiwifruit) Pathway aew04016   MAPK signaling pathway - plant aew04070   Phosphatidylinositol signaling system aew04075   Plant hormone signal transduction aew04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:aew00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     130770313    04070 Phosphatidylinositol signaling system     130770313    04075 Plant hormone signal transduction     130770313  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     130770313  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aew01009]     130770313   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aew04131]     130770313    03036 Chromosome and associated proteins [BR:aew03036]     130770313   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aew04147]     130770313 Protein phosphatases and associated proteins [BR:aew01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      130770313 Membrane trafficking [BR:aew04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     130770313 Chromosome and associated proteins [BR:aew03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      130770313 Exosome [BR:aew04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    130770313 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Fe_hyd_lg_C DUF6279 PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  130770313 NCBI-ProteinID:  XP_057483716 LinkDB All DBs Position 28:16421395..16423809 Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcagctaaccgacgatcagatctctgaattcaaggaggctttcagcctattc gacaaggatggcgatggatgtatcactaccaaggagcttggcacagtgatgcggtctttg ggacagaacccaacagaagccgagctgcaggatatgatcaatgaggttgatgctgatgga aatgggacaattgatttcccagagttcctcaacttgatggcccggaagatgaaggatacc gactctgaggaggagctgaaggaagctttccgggttttcgacaaggaccagaatggcttc atctctgcagctgagctccgccatgttatgacaaatcttggtgaaaagcttacagatgag gaagttgacgagatgattcgtgaggctgatgtggatggcgatggtcagatcaactacgag gagttcgtcaaggtcatgatggccaagtga

DBGET integrated database retrieval system