Actinidia eriantha (wild kiwifruit): 130770317 Help Entry 130770317         CDS       T09464                                  Name (RefSeq) calmodulin-1-like   KO K02183   calmodulin Organism aew  Actinidia eriantha (wild kiwifruit) Pathway aew04016   MAPK signaling pathway - plant aew04070   Phosphatidylinositol signaling system aew04075   Plant hormone signal transduction aew04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:aew00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     130770317    04070 Phosphatidylinositol signaling system     130770317    04075 Plant hormone signal transduction     130770317  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     130770317  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aew01009]     130770317   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aew04131]     130770317    03036 Chromosome and associated proteins [BR:aew03036]     130770317   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aew04147]     130770317 Protein phosphatases and associated proteins [BR:aew01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      130770317 Membrane trafficking [BR:aew04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     130770317 Chromosome and associated proteins [BR:aew03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      130770317 Exosome [BR:aew04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    130770317 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_9 AIF-1 EF-hand_5 Dockerin_1 EF_EFCAB10_C Caleosin EH UPF0154 EF-hand_11 DUF5580_M ExbD Motif Other DBs NCBI-GeneID:  130770317 NCBI-ProteinID:  XP_057483721 LinkDB All DBs Position 28:16381085..16384261 Genome browser AA seq 149 aa AA seqDB search MADQFTNDQIAEFKETFSFFDKDGDGCITTKDLGTVMRSLGQNPTEAELQDMINGADTDG HGAVYFPGFLNLMARKKKDTDYEEELKETFRVFDKDQNGFFSAADFCHVMTNLGEKLTNE EVNEMIREVDVDGDGQISYEDFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcagttcaccaacgatcagatcgccgaattcaaggagactttcagcttcttc gacaaggacggcgatggttgcatcactaccaaggaccttggcacagtgatgcggtctttg ggacagaacccaacagaagctgagcttcaggacatgatcaatggggctgatactgatgga catggggcagtttatttcccagggttcctcaacttgatggcccggaagaagaaggataca gactatgaggaggagctgaaggaaactttccgggtttttgacaaggaccagaacggcttc ttctctgcagctgatttctgccatgttatgacaaatctcggtgaaaagctcacaaatgag gaagttaacgagatgattcgtgaggttgatgtggatggtgatgggcagatcagctatgag gattttgtcaaggtcatgatggccaagtga

DBGET integrated database retrieval system