Actinidia eriantha (wild kiwifruit): 130771920 Help Entry 130771920         CDS       T09464                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism aew  Actinidia eriantha (wild kiwifruit) Brite KEGG Orthology (KO) [BR:aew00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:aew03041]     130771920   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aew04052]     130771920 Spliceosome [BR:aew03041]  Complex B   Other components    Complex B specific factors     130771920 Cytokines and neuropeptides [BR:aew04052]  Neuropeptides   Unclassified    130771920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Ubiquitin_4 Rad60-SLD Motif Other DBs NCBI-GeneID:  130771920 NCBI-ProteinID:  XP_057485617 LinkDB All DBs Position 3:complement(16925986..16932476) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRADKIRIQKWYNVYKDHITLRDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatagaggtggtgttgaacgatcggctggggaagaaggttcgggtgaagtgcaacgac gacgacacaatcggagacctgaagaagctggtggcggcgcagacgggcacgcgcgccgat aagatccgcatccagaagtggtacaacgtctacaaggaccacatcaccctccgcgactac gagatccacgacggcatgggcctcgaactctactacaactag

DBGET integrated database retrieval system