Actinidia eriantha (wild kiwifruit): 130777829 Help Entry 130777829         CDS       T09464                                  Name (RefSeq) sm-like protein LSM8   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism aew  Actinidia eriantha (wild kiwifruit) Pathway aew03018   RNA degradation aew03040   Spliceosome Brite KEGG Orthology (KO) [BR:aew00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     130777829   09123 Folding, sorting and degradation    03018 RNA degradation     130777829  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:aew03019]     130777829    03041 Spliceosome [BR:aew03041]     130777829 Messenger RNA biogenesis [BR:aew03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      130777829   mRNA degradation factors    5'-3' decay     Lsm complex      130777829 Spliceosome [BR:aew03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     130777829 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  130777829 NCBI-ProteinID:  XP_057492239 LinkDB All DBs Position 5:2481211..2485282 Genome browser AA seq 77 aa AA seqDB search MSSGPGLESLVDQTISVKTNDGRNIVEGVQQLVLGLYIIRGDNISIVGELDEELDASLDL SKLRAHPLKPVIHGQET NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtcaagtgggcctggacttgaatctcttgttgaccaaacaatttcagtcaaaacaaat gatggacgcaacatagtggaaggtgtccaacagcttgtgttaggtttatacatcattaga ggcgacaacataagtattgttggggaactagatgaagagctggacgccagcctagatttg tcaaagctgagagctcatccactaaagcctgttatccatggacaagaaacataa

DBGET integrated database retrieval system