Actinidia eriantha (wild kiwifruit): 130783300 Help Entry 130783300         CDS       T09464                                  Name (RefSeq) probable histone H2B.1   KO K11252   histone H2B Organism aew  Actinidia eriantha (wild kiwifruit) Brite KEGG Orthology (KO) [BR:aew00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:aew03036]     130783300   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aew04147]     130783300 Chromosome and associated proteins [BR:aew03036]  Eukaryotic type   Nucleosome assembly factors    Histones     130783300 Exosome [BR:aew04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130783300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  130783300 NCBI-ProteinID:  XP_057498854 LinkDB All DBs Position 8:25542327..25543909 Genome browser AA seq 93 aa AA seqDB search MATKTEKKPAEKKSAEEKKSTVEKKLKAWKKLPTEGRASAAGDKKKRTNKSIETYKIYIF KVLKQVHPDIGISSKAMGIMNSFINDIFEKLAK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcgaccaagaccgagaaaaagcccgccgagaagaagtcggcggaggagaagaagtcc acggtggagaagaagctgaaggcgtggaagaagcttccgacggagggccgcgcctcggcg gccggagataagaagaagaggacgaataagagcattgagacgtacaagatctacatcttc aaggtgctgaagcaggtccacccggacatcgggatctccagcaaggccatgggcatcatg aacagcttcatcaacgacatcttcgagaagcttgccaagtag

DBGET integrated database retrieval system