Actinidia eriantha (wild kiwifruit): 130784317 Help Entry 130784317         CDS       T09464                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism aew  Actinidia eriantha (wild kiwifruit) Pathway aew03083   Polycomb repressive complex aew04120   Ubiquitin mediated proteolysis aew04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:aew00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     130784317    04120 Ubiquitin mediated proteolysis     130784317   09126 Chromosome    03083 Polycomb repressive complex     130784317  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aew04131]     130784317    04121 Ubiquitin system [BR:aew04121]     130784317    03036 Chromosome and associated proteins [BR:aew03036]     130784317 Membrane trafficking [BR:aew04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     130784317 Ubiquitin system [BR:aew04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      130784317    Cul7 complex      130784317 Chromosome and associated proteins [BR:aew03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      130784317   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      130784317 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  130784317 NCBI-ProteinID:  XP_057500134 LinkDB All DBs Position 9:16799792..16804036 Genome browser AA seq 155 aa AA seqDB search MSTSKTIVLKSSDGETFEVEEAVAVESQTIKHMIEDNCANTSIPLPNVTSKILAKVIEYC KRHVDPPKSDDKSPEDDLKKFDDEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcgacttcgaaaacgatcgtgctgaagagctcggacggtgagacgttcgaggtggag gaggcggtggcggtggagtcgcagacgatcaagcacatgatcgaggacaactgcgccaac accagcattcctcttcccaacgtcaccagtaagatcctggccaaggtcatcgagtactgc aagaggcacgtcgaccctcccaagtccgacgacaagtcacccgaggacgatctcaagaag tttgacgacgagttcgtcaaagtcgaccaggccaccctcttcgatctcatcctggctgca aattatctgaacatcaagagcctcctagatctgacatgtcagacagtggcagacatgatc aaggggaagacaccagaggagatccgcaagacattcaacatcaagaatgacttcactcct gaggaagaagaggaggttcgcagggagaatgcttgggcatttgagtga

DBGET integrated database retrieval system