Actinidia eriantha (wild kiwifruit): 130785332 Help Entry 130785332         CDS       T09464                                  Name (RefSeq) calmodulin-2/4-like   KO K02183   calmodulin Organism aew  Actinidia eriantha (wild kiwifruit) Pathway aew04016   MAPK signaling pathway - plant aew04070   Phosphatidylinositol signaling system aew04075   Plant hormone signal transduction aew04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:aew00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     130785332    04070 Phosphatidylinositol signaling system     130785332    04075 Plant hormone signal transduction     130785332  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     130785332  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:aew01009]     130785332   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aew04131]     130785332    03036 Chromosome and associated proteins [BR:aew03036]     130785332   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aew04147]     130785332 Protein phosphatases and associated proteins [BR:aew01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      130785332 Membrane trafficking [BR:aew04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     130785332 Chromosome and associated proteins [BR:aew03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      130785332 Exosome [BR:aew04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    130785332 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_9 EF-hand_5 AIF-1 Dockerin_1 EF_EFCAB10_C EF-hand_11 Motif Other DBs NCBI-GeneID:  130785332 NCBI-ProteinID:  XP_057501475 LinkDB All DBs Position 9:complement(4984991..4985371) Genome browser AA seq 113 aa AA seqDB search MRSLGQNPTEAELQDMINEFDADGNGAVYFPGFLNLMARKMKDTDYEEELKEAFRVFDKD QNGFFSAADFCHVMTNLGEKFTNEEVDEMIRAADVDGDGQISYEDFVKVVMAK NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgcggtctttgggacagaacccaacagaagctgagcttcaagacatgatcaatgagttt gatgctgatggaaatggggcagtttatttcccagggttcctcaacttgatggcccggaag atgaaggataccgactatgaggaggagctgaaggaagctttccgggtttttgacaaggac cagaacggcttcttctctgcagctgatttctgccatgttatgacaaatcttggtgaaaag ttcacaaatgaggaagttgacgagatgattcgtgctgctgatgtggatggtgatgggcag atcagctatgaggattttgtcaaggtcgtgatggccaagtga

DBGET integrated database retrieval system