Actinidia eriantha (wild kiwifruit): 130785376 Help Entry 130785376         CDS       T09464                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism aew  Actinidia eriantha (wild kiwifruit) Pathway aew04145   Phagosome aew04148   Efferocytosis aew04517   IgSF CAM signaling aew04518   Integrin signaling aew04620   Toll-like receptor signaling pathway aew05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:aew00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     130785376    04518 Integrin signaling     130785376  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     130785376    04148 Efferocytosis     130785376  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     130785376  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     130785376  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aew04131]     130785376   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aew04147]     130785376    04031 GTP-binding proteins [BR:aew04031]     130785376 Membrane trafficking [BR:aew04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     130785376  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     130785376   Macropinocytosis    Ras GTPases     130785376  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     130785376 Exosome [BR:aew04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130785376   Exosomal proteins of other body fluids (saliva and urine)    130785376   Exosomal proteins of colorectal cancer cells    130785376   Exosomal proteins of bladder cancer cells    130785376 GTP-binding proteins [BR:aew04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     130785376 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Sua5_C Motif Other DBs NCBI-GeneID:  130785376 NCBI-ProteinID:  XP_057501518 LinkDB All DBs Position 9:16764674..16771523 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENISKKWIPELRHYAPGVPVVLVGTKL DLREDKQFFVDHPGAVPITTAQGEEMKRLIGAAAYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKRRGQKGCSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtcgaggttcatcaagtgcgtcaccgtcggcgacggagctgttggcaagacc tgtatgcttatctcctacaccagcaacaccttccccactgattatgtgccgactgttttc gacaattttagtgcaaatgtggttgtggatgggagcactgttaacttagggttgtgggat actgcaggtcaggaggactacaacagattaagacctctgagctatcgtggggccgatgtc tttatacttgcattttctcttattagcaaggccagctatgaaaatatatcaaaaaagtgg attcctgagttgaggcattatgctcctggggttccagtagttcttgttggaacaaagcta gatcttcgggaagataagcagttttttgtagaccaccctggtgcggtgcccattacaaca gctcagggagaggagatgaaaaggctgattggagctgctgcttacattgaatgtagttcg aaaacccaacagaatgtgaaagctgtttttgatgccgccattaaggtggttctccaacca ccgaaacagaagaagaaaaagaagagaagaggccaaaaaggctgcagtatcttgtga

DBGET integrated database retrieval system