Actinidia eriantha (wild kiwifruit): 130788075 Help Entry 130788075         CDS       T09464                                  Name (RefSeq) ras-related protein Rab7-like   KO K07897   Ras-related protein Rab-7A Organism aew  Actinidia eriantha (wild kiwifruit) Pathway aew04144   Endocytosis aew04145   Phagosome aew04148   Efferocytosis Brite KEGG Orthology (KO) [BR:aew00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     130788075    04145 Phagosome     130788075    04148 Efferocytosis     130788075  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aew04131]     130788075   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:aew04147]     130788075    04031 GTP-binding proteins [BR:aew04031]     130788075 Membrane trafficking [BR:aew04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     130788075 Exosome [BR:aew04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130788075   Exosomal proteins of other body fluids (saliva and urine)    130788075   Exosomal proteins of colorectal cancer cells    130788075   Exosomal proteins of bladder cancer cells    130788075 GTP-binding proteins [BR:aew04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     130788075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_16 nSTAND3 AAA_22 AAA_7 cobW NTPase_1 AAA_24 Septin NACHT nSTAND1 PduV-EutP AAA_5 AAA_14 ATPase_2 DAP3 NB-ARC Sigma54_activat Motif Other DBs NCBI-GeneID:  130788075 NCBI-ProteinID:  XP_057504590 LinkDB All DBs Position 11:5083408..5098490 Genome browser AA seq 142 aa AA seqDB search MYFRSKVIVLGDSGVGKTSLMNQYVHKRFSQQYKATIGADFVTKELQRDDRLVTLQIWDT AGQERFQSLGVAFYRGADCCILVYDVNDKRSFDTLDNWHEEFLKQANPPDPKTFPFILLG NKIDIDGGNSQVVSEKKVLRIR NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgtacttccgtagcaaggtcatcgttctcggggacagtggggttggcaagacgtcattg atgaatcaatatgtacataagaggttcagtcagcaatataaagctacaattggggctgat tttgtcaccaaagaactacaaagagatgacaggcttgtcactctacagatatgggacaca gctgggcaagagaggtttcagagtcttggagttgccttttatagaggtgcagactgctgc attctagtatacgatgttaacgacaaaagatcatttgatactcttgacaattggcatgaa gaatttctcaaacaggcaaatccacctgatcctaagacatttccgtttatattgcttgga aacaagattgatatagacggtggaaatagccaagtggtttctgagaagaaagtgttgaga atcagatga

DBGET integrated database retrieval system