Asticcacaulis excentricus: Astex_2789 Help Entry Astex_2789        CDS       T01378                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aex  Asticcacaulis excentricus Pathway aex01100   Metabolic pathways aex01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aex00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Astex_2789    00074 Mycolic acid biosynthesis     Astex_2789   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Astex_2789 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ADU14427 UniProt:  E8RSF6 LinkDB All DBs Position 2:464631..464870 Genome browser AA seq 79 aa AA seqDB search MSEVLERVRKIVIDHLDADPDKVTEKASFIDDLEADSLDIVELVMAFEEEFDIEIPDDSA EHILTVGDAVNYIQEKLSA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtctgaagttcttgaacgtgttcgcaagattgtgattgatcatctggatgctgatccg gataaggtcacggaaaaggcgagcttcatcgacgatctggaagccgacagcctcgacatc gttgagcttgtcatggctttcgaagaagaattcgacatcgaaattcctgatgactcggct gagcacatcctgaccgttggcgacgccgtcaactacattcaggaaaagctttccgcttaa

DBGET integrated database retrieval system