Alcaligenes faecalis ZD02: UZ73_05125 Help Entry UZ73_05125        CDS       T04157                                  Name (GenBank) exodeoxyribonuclease VII   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism afa  Alcaligenes faecalis ZD02 Pathway afa03430   Mismatch repair Brite KEGG Orthology (KO) [BR:afa00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     UZ73_05125  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:afa03400]     UZ73_05125 Enzymes [BR:afa01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      UZ73_05125 DNA repair and recombination proteins [BR:afa03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      UZ73_05125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S DUF2959 DUF5930 Motif Other DBs NCBI-ProteinID:  ALO37699 UniProt:  A0A0A2N537 LinkDB All DBs Position complement(1121931..1122197) Genome browser AA seq 88 aa AA seqDB search MVKSRDDNQSAQAPAQQDFESALAQLEALVARMESGALPLEQALQAYEQGVELAQLCQRK LDLAQEQVSVLQGNLLRPLSGDEAVGDS NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggttaaatctcgcgatgataatcaaagcgcccaggcgccagcccagcaggatttcgag tccgctctggcgcaactggaagcgctggtcgctcgcatggaaagcggggcattgccgctg gagcaggctttgcaggcttacgagcagggcgtggagttagcccaattgtgtcagcgcaag ctggaccttgcacaagaacaagtcagcgtattgcaaggcaatctgctgcgccccttgtcc ggggatgaagctgttggagatagttaa

DBGET integrated database retrieval system