Alcaligenes faecalis ZD02: UZ73_05210
Help
Entry
UZ73_05210 CDS
T04157
Symbol
truB
Name
(GenBank) tRNA pseudouridine synthase B
KO
K03177
tRNA pseudouridine55 synthase [EC:
5.4.99.25
]
Organism
afa
Alcaligenes faecalis ZD02
Brite
KEGG Orthology (KO) [BR:
afa00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03016 Transfer RNA biogenesis [BR:
afa03016
]
UZ73_05210 (truB)
Enzymes [BR:
afa01000
]
5. Isomerases
5.4 Intramolecular transferases
5.4.99 Transferring other groups
5.4.99.25 tRNA pseudouridine55 synthase
UZ73_05210 (truB)
Transfer RNA biogenesis [BR:
afa03016
]
Eukaryotic type
tRNA modification factors
Psudouridine synthases
UZ73_05210 (truB)
Prokaryotic type
UZ73_05210 (truB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TruB_N
TruB_C_2
Motif
Other DBs
NCBI-ProteinID:
ALO37715
UniProt:
A0A0A2N5I0
LinkDB
All DBs
Position
complement(1141893..1142645)
Genome browser
AA seq
250 aa
AA seq
DB search
MATRKRGQLIDGVLLLDKSDGMSSNHALQRARRTLDARKAGHTGTLDPFATGLLVCCFGR
ATKISATMLEADKAYEATLQFGQETDSGDLTGNVVSQAPADFAGVTLEALEAVLPAFRGP
ITQVPPMYSALKRDGKPLYEYARQGIELEREARHLVIHDLQVQDFTPQSARLFVRCSKGT
YIRTLAQDIGRALGCFAHLTALRRTELGPFHIDDAYTLDGLQAMEDPMSALLAIESLPTE
ILPKKLQSEG
NT seq
753 nt
NT seq
+upstream
nt +downstream
nt
atggctacgcgaaaacgcgggcagttgattgacggtgtgctgctactggacaagtccgac
ggaatgtccagcaaccacgccttgcagcgtgctcgccgcactctggatgcccgcaaagct
ggccatactggaaccctggacccgtttgcaacgggcctgctggtttgctgttttggccgg
gctaccaagatttccgccacgatgctggaagcagacaaagcctatgaagctaccttgcag
tttggacaggaaaccgattcaggtgacttgaccggcaatgtggtgtcccaggctccggca
gattttgccggtgtcaccctcgaggcgctggaagcagtactacctgctttccgaggaccc
attacccaggtgccgcccatgtattccgcgctcaagcgcgatggcaagcccctgtatgaa
tatgcccgtcagggtatagagctggaacgtgaggcacgacatctcgtgattcacgatttg
caggtgcaagactttacgccgcaatcggcgcgtctgtttgtacgttgcagcaagggaacc
tatatccggaccctggcgcaagacattggacgtgctctggggtgttttgcccatctgacg
gccttgcgccggacagagttaggaccttttcatatcgacgacgcctacaccctggacggg
ttgcaggcgatggaagacccgatgtcggccttgctggccatcgagagcttgcctaccgag
attttgcccaaaaaacttcaatcagaaggatga
DBGET
integrated database retrieval system