Alcaligenes faecalis ZD02: UZ73_17830 Help Entry UZ73_17830        CDS       T04157                                  Name (GenBank) phenol hydroxylase   KO K16249   phenol/toluene 2-monooxygenase (NADH) P0/A0 Organism afa  Alcaligenes faecalis ZD02 Pathway afa00361   Chlorocyclohexane and chlorobenzene degradation afa00362   Benzoate degradation afa00623   Toluene degradation afa01100   Metabolic pathways afa01120   Microbial metabolism in diverse environments afa01220   Degradation of aromatic compounds Module afa_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:afa00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     UZ73_17830    00361 Chlorocyclohexane and chlorobenzene degradation     UZ73_17830    00623 Toluene degradation     UZ73_17830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_hyd_sub B3 Motif Other DBs NCBI-ProteinID:  ALO39960 UniProt:  A0A0M7DEF7 LinkDB All DBs Position 3941739..3942011 Genome browser AA seq 90 aa AA seqDB search MADTSLPTLTKYVRVRSPANARFVEFDFAIGQADLFVELVMPPAAFEQFCLQNNVQPMSE EQMRVNDENEEKWRFGYDTLVGNSRQAEAQ NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggcagacacgagcttgcccactttgacgaagtacgtacgcgtacgcagtcccgccaat gcgcgctttgtggaatttgattttgctattggccaggcggacctgtttgtggaactggtc atgccaccggcggcatttgagcagttttgcctgcagaacaatgtccagcccatgagcgaa gagcaaatgcgggtcaatgacgagaacgaagaaaaatggcgttttggttatgacactttg gtcggtaacagccgccaggctgaagcccagtag

DBGET integrated database retrieval system