Anoplopoma fimbria (sablefish): 129089033 Help Entry 129089033         CDS       T09102                                  Symbol ccl25a Name (RefSeq) C-C motif chemokine 25   KO K13072   C-C motif chemokine 25 Organism afb  Anoplopoma fimbria (sablefish) Pathway afb04060   Cytokine-cytokine receptor interaction afb04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:afb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129089033 (ccl25a)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     129089033 (ccl25a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:afb04052]     129089033 (ccl25a) Cytokines and neuropeptides [BR:afb04052]  Cytokines   Chemokines    129089033 (ccl25a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Chlam_OMP3 Motif Other DBs NCBI-GeneID:  129089033 NCBI-ProteinID:  XP_054452326 LinkDB All DBs Position 3:25514052..25516497 Genome browser AA seq 107 aa AA seqDB search MRFNTMFFLLILSSLCLALAQMTYEDCCFKYVKQMNPRIQKHAVEYRRQVLDGGCNIPAV IFTMRKGRELCTDPRERWVNDLVKKIDKRALRNDHNKSKKHQQPNRN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgcggttcaacacgatgttcttcctgctgatcctatcctctctctgcctcgcactggcg caaatgacctatgaagactgctgctttaagtatgtaaaacaaatgaacccgcgcattcaa aaacacgcagtggagtacagacgtcaggtgttagatggaggctgcaacatccctgctgta atcttcacaatgaggaaggggcgtgagctgtgcacggaccccagagagagatgggtaaac gacctggtgaagaagattgacaaaagggcactcagaaatgaccacaataaatcaaagaag caccaacagccgaacagaaactga

DBGET integrated database retrieval system