Anoplopoma fimbria (sablefish): 129090325 Help Entry 129090325         CDS       T09102                                  Name (RefSeq) insulin-like isoform X1   KO K04526   insulin Organism afb  Anoplopoma fimbria (sablefish) Pathway afb04010   MAPK signaling pathway afb04068   FoxO signaling pathway afb04081   Hormone signaling afb04114   Oocyte meiosis afb04140   Autophagy - animal afb04150   mTOR signaling pathway afb04810   Regulation of actin cytoskeleton afb04910   Insulin signaling pathway afb04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:afb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129090325    04068 FoxO signaling pathway     129090325    04150 mTOR signaling pathway     129090325   09133 Signaling molecules and interaction    04081 Hormone signaling     129090325  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129090325   09143 Cell growth and death    04114 Oocyte meiosis     129090325   09142 Cell motility    04810 Regulation of actin cytoskeleton     129090325  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     129090325    04914 Progesterone-mediated oocyte maturation     129090325  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:afb04052]     129090325 Cytokines and neuropeptides [BR:afb04052]  Neuropeptides   Unclassified    129090325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  129090325 NCBI-ProteinID:  XP_054453914 LinkDB All DBs Position 4:7989830..7992273 Genome browser AA seq 111 aa AA seqDB search MARVPCAVSLLFLLALYSPAVSPAPAAHLCGSHLVDTLYFICGERGFFYSPNRPRKRDLE HLLGFLSQRARQEQQLWKALSGRGEPKVKRGIVEQCCHKPCSIYHLEGYCD NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggccagggtaccatgtgcagtgtccctgctgttcctgctggccctctactctccagcg gtgtccccggcccccgccgcgcacctgtgtggctcccacctggtggacaccctctacttc atatgtggcgagcggggctttttctacagtccaaacagaccccgcaagcgggatttggaa catctgcttgggttcctgtctcaaagggccagacaggagcagcagctgtggaaggctctg tccggccgtggagagcccaaggtgaagagaggcatcgtggagcagtgctgccataagcca tgcagcatctaccacctggagggctactgcgactga

DBGET integrated database retrieval system