Anoplopoma fimbria (sablefish): 129091419 Help Entry 129091419         CDS       T09102                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism afb  Anoplopoma fimbria (sablefish) Pathway afb04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:afb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     129091419  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:afb04121]     129091419    03400 DNA repair and recombination proteins [BR:afb03400]     129091419 Ubiquitin system [BR:afb04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      129091419    Cul5 complex      129091419 DNA repair and recombination proteins [BR:afb03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      129091419 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD LED_rpt Motif Other DBs NCBI-GeneID:  129091419 NCBI-ProteinID:  XP_054455000 LinkDB All DBs Position 5:16177193..16181968 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDQSLEDSKTLGDC GFTNQTARPQAPATVGLAFRINDEMFEQLHVEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgatccggcgtcacaagaccacaatcttcacagatgccaaggag tctaccactgtgtatgagctgaagcgtattgttgaaggaattcttaagagaccacctgaa gaccagaggctgtacaaagatgaccagtcgctagaggacagcaaaactcttggagactgt ggatttaccaaccagactgccagacctcaagctccagctacagttggtctggcctttcgc ataaatgatgagatgtttgaacagctccacgtcgaggccttctccagccccccagagctc cctgatgtgatgaagcctcaggactccggtagcactgccaacgaacaggctgtgcagtga

DBGET integrated database retrieval system