Anoplopoma fimbria (sablefish): 129093915 Help Entry 129093915         CDS       T09102                                  Symbol cxcl19 Name (RefSeq) C-X-C motif chemokine 19   KO K10030   interleukin 8 Organism afb  Anoplopoma fimbria (sablefish) Pathway afb04060   Cytokine-cytokine receptor interaction afb04218   Cellular senescence afb04620   Toll-like receptor signaling pathway afb04621   NOD-like receptor signaling pathway afb04622   RIG-I-like receptor signaling pathway afb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:afb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129093915 (cxcl19)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     129093915 (cxcl19)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129093915 (cxcl19)    04621 NOD-like receptor signaling pathway     129093915 (cxcl19)    04622 RIG-I-like receptor signaling pathway     129093915 (cxcl19)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129093915 (cxcl19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:afb04052]     129093915 (cxcl19)    00536 Glycosaminoglycan binding proteins [BR:afb00536]     129093915 (cxcl19) Cytokines and neuropeptides [BR:afb04052]  Cytokines   Chemokines    129093915 (cxcl19) Glycosaminoglycan binding proteins [BR:afb00536]  Heparan sulfate / Heparin   Chemokines    129093915 (cxcl19) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  129093915 NCBI-ProteinID:  XP_054458020 LinkDB All DBs Position 7:complement(6166607..6169575) Genome browser AA seq 105 aa AA seqDB search MKLCILLISGTLLVLTHGMPPISRDYNTHCRCLQVESRIIPPDNLRSIKLFPEGPHCPDI EVIAGLANGEKVCLNPRSSWVKKLIHFVLEKQLHQQGAALPKNRE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcatcctcctcatttccgggaccctgcttgtcctcactcatggaatgcca ccaatcagcagagactacaacacacactgccgctgccttcaggtggagtcgaggatcatc cctccggacaacctgaggagcatcaagctcttccccgaagggccccactgccccgatata gaagtcatagctggactggccaacggggagaaagtttgcctgaaccctcggtcctcctgg gtgaagaagctgatccactttgtcctcgagaagcaacttcatcagcagggagcggcactt ccaaagaatcgagaataa

DBGET integrated database retrieval system