Anoplopoma fimbria (sablefish): 129095074 Help Entry 129095074         CDS       T09102                                  Symbol ccl25b Name (RefSeq) C-C motif chemokine 25b   KO K13072   C-C motif chemokine 25 Organism afb  Anoplopoma fimbria (sablefish) Pathway afb04060   Cytokine-cytokine receptor interaction afb04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:afb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129095074 (ccl25b)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     129095074 (ccl25b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:afb04052]     129095074 (ccl25b) Cytokines and neuropeptides [BR:afb04052]  Cytokines   Chemokines    129095074 (ccl25b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  129095074 NCBI-ProteinID:  XP_054459418 LinkDB All DBs Position 8:19940742..19943739 Genome browser AA seq 100 aa AA seqDB search MKSQALFLLLILSCMCLTLAQGSFGNCCLGYLTGMTSRAKKNIERYKMQETDGDCNIRAV VFVMKKKPNKKQGTRCANPNDNWVQKLMQDVNERNQNLTT NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaagtcccaagctcttttcctacttctgatcctctcctgcatgtgcctgactcttgca caaggctcgtttggaaactgctgcctcggctatctaacagggatgacatccagggcaaag aaaaacattgaaagatacaagatgcaggaaacagatggtgattgcaacatcagagctgtt gtgtttgtgatgaagaagaagccaaataaaaagcaggggactcgctgtgccaatccgaat gacaattgggtccagaagctgatgcaggatgtgaatgagagaaatcagaatttgaccact taa

DBGET integrated database retrieval system