Anoplopoma fimbria (sablefish): 129100995 Help Entry 129100995         CDS       T09102                                  Symbol rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism afb  Anoplopoma fimbria (sablefish) Pathway afb04010   MAPK signaling pathway afb04137   Mitophagy - animal afb04140   Autophagy - animal afb04218   Cellular senescence afb04371   Apelin signaling pathway afb04519   Cadherin signaling afb04625   C-type lectin receptor signaling pathway afb04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:afb00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129100995 (rras2)    04371 Apelin signaling pathway     129100995 (rras2)   09133 Signaling molecules and interaction    04519 Cadherin signaling     129100995 (rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129100995 (rras2)    04137 Mitophagy - animal     129100995 (rras2)   09143 Cell growth and death    04218 Cellular senescence     129100995 (rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     129100995 (rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129100995 (rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:afb04147]     129100995 (rras2)    04031 GTP-binding proteins [BR:afb04031]     129100995 (rras2) Exosome [BR:afb04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    129100995 (rras2)   Exosomal proteins of bladder cancer cells    129100995 (rras2) GTP-binding proteins [BR:afb04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     129100995 (rras2) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 SLFN-g3_helicase RHG35-p190PhoGP_pG1 FeoB_N Motif Other DBs NCBI-GeneID:  129100995 NCBI-ProteinID:  XP_054466552 LinkDB All DBs Position 2:complement(19620976..19648660) Genome browser AA seq 202 aa AA seqDB search MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERAA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLELQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPTRKEKDKSGCHCVIV NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggcaggctggaaggacggctcggtgcaggagaagtatcggctggtcgtggtcggaggc ggtggtgtcgggaaatcagccctgactatccagtttattcagtcgtacttcgtcaccgac tatgaccccacgattgaagactcttataccaagcagtgtgtgattgacgaaagggcggcc aggctcgacatcctcgacacggctggacaggaagagtttggagccatgagagaacaatac atgaggacaggggagggcttcctgctcgtcttctcagtcactgacagaggaagctttgag gaaatctacaaattccaaagacaaattctccgagtgaaagacagagatgaattccctatg atcctcgtaggaaacaaagctgatctggaactacagagacaagtaacccaggaagagggc cagcagctggccagacaactgaaggtgacatacatggaggcttcagccaaaattcgtatg aacgtagaccaggctttccacgagctggttagagtaatcaggaaattccaagagcaggaa tgtccaccgtcgccagaacctacaagaaaagagaaagacaagagcggctgccattgtgtg atcgtctga

DBGET integrated database retrieval system