Anoplopoma fimbria (sablefish): 129101850 Help Entry 129101850         CDS       T09102                                  Name (RefSeq) C-C motif chemokine 25-like   KO K05513   C-C motif chemokine 28 Organism afb  Anoplopoma fimbria (sablefish) Pathway afb04060   Cytokine-cytokine receptor interaction afb04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:afb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129101850  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     129101850  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:afb04052]     129101850 Cytokines and neuropeptides [BR:afb04052]  Cytokines   Chemokines    129101850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  129101850 NCBI-ProteinID:  XP_054467776 LinkDB All DBs Position 13:complement(8691942..8692939) Genome browser AA seq 93 aa AA seqDB search MELKVAFVIVCLCALAITSTEAGIPKCCIKTQKHIPFGLLLKVQRVTMQHSSGPCDIPAM ILYLKGRMKPICADPKVKKILNRINQNKWRPAY NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggagctgaaagttgcgtttgtgattgtctgcctctgcgctttggccatcacctcaact gaagctggcatcccaaaatgctgtatcaaaacacaaaagcacatccctttcggactgctg ctgaaggttcagagagtaaccatgcagcacagcagcgggccctgtgacatccctgccatg atactgtatttaaaaggcagaatgaagcccatctgtgctgatcccaaagtgaagaaaatc ctgaatcggataaatcagaacaagtggagaccagcctactga

DBGET integrated database retrieval system