Anoplopoma fimbria (sablefish): 129104479 Help Entry 129104479         CDS       T09102                                  Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism afb  Anoplopoma fimbria (sablefish) Pathway afb04020   Calcium signaling pathway afb04070   Phosphatidylinositol signaling system afb04114   Oocyte meiosis afb04218   Cellular senescence afb04261   Adrenergic signaling in cardiomyocytes afb04270   Vascular smooth muscle contraction afb04371   Apelin signaling pathway afb04625   C-type lectin receptor signaling pathway afb04744   Phototransduction afb04910   Insulin signaling pathway afb04912   GnRH signaling pathway afb04916   Melanogenesis Brite KEGG Orthology (KO) [BR:afb00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     129104479    04020 Calcium signaling pathway     129104479    04070 Phosphatidylinositol signaling system     129104479  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     129104479    04218 Cellular senescence     129104479  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129104479   09152 Endocrine system    04910 Insulin signaling pathway     129104479    04912 GnRH signaling pathway     129104479    04916 Melanogenesis     129104479   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     129104479    04270 Vascular smooth muscle contraction     129104479   09157 Sensory system    04744 Phototransduction     129104479  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:afb01009]     129104479   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:afb04131]     129104479    03036 Chromosome and associated proteins [BR:afb03036]     129104479   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:afb04147]     129104479 Protein phosphatases and associated proteins [BR:afb01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      129104479 Membrane trafficking [BR:afb04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     129104479 Chromosome and associated proteins [BR:afb03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      129104479 Exosome [BR:afb04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    129104479 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_9 AIF-1 EFhand_Ca_insen p25-alpha EF-hand_11 EF_EFCAB10_C GPHH DUF5580_M Motif Other DBs NCBI-GeneID:  129104479 NCBI-ProteinID:  XP_054471165 LinkDB All DBs Position 2:7852654..7858037 Genome browser AA seq 153 aa AA seqDB search MAKFFTPVQIHEFKECFSLYDKKQKGKIVVKDLITVMRCLGTSPTFGEIDRHLQVHKIEK NGELDFSTFLTMMHRQMQQEDSKTEILDAFRMTDKQKKGYIQASELRAKLTLLGEKLTNK EVDELFKEANVKSNGSINYEDFTQMVTLPPVDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggctaaattcttcacaccagttcaaatacacgagttcaaggagtgcttctccttgtac gacaagaaacaaaagggcaagattgttgtcaaagatctgatcacggttatgcgctgtctg ggtacaagccccacgttcggggaaattgacagacatctacaagttcacaaaatagaaaag aacggcgagctggacttctccacctttctgacgatgatgcacagacagatgcagcaggaa gactccaagactgaaatcctggacgcctttaggatgacggacaaacagaagaaaggatac atccaggcgtccgagctccgggccaagctcaccttgttgggggagaaactcacaaacaaa gaagtggatgaactcttcaaagaggcaaacgtcaagtccaacgggagcatcaactatgaa gatttcacgcagatggtgacgctgccaccggtcgattactga

DBGET integrated database retrieval system