Anoplopoma fimbria (sablefish): 129105393 Help Entry 129105393         CDS       T09102                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism afb  Anoplopoma fimbria (sablefish) Pathway afb04137   Mitophagy - animal afb04140   Autophagy - animal afb04144   Endocytosis afb04145   Phagosome afb04148   Efferocytosis afb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:afb00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129105393    04145 Phagosome     129105393    04140 Autophagy - animal     129105393    04137 Mitophagy - animal     129105393    04148 Efferocytosis     129105393  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129105393  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:afb04131]     129105393   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:afb04147]     129105393    04031 GTP-binding proteins [BR:afb04031]     129105393 Membrane trafficking [BR:afb04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     129105393 Exosome [BR:afb04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129105393   Exosomal proteins of other body fluids (saliva and urine)    129105393   Exosomal proteins of colorectal cancer cells    129105393   Exosomal proteins of bladder cancer cells    129105393 GTP-binding proteins [BR:afb04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     129105393 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_16 NTPase_1 ATPase_2 AAA_22 AAA_7 AAA_24 G-alpha AAA_5 AAA_14 NACHT NB-ARC SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  129105393 NCBI-ProteinID:  XP_054472360 LinkDB All DBs Position 17:14433900..14442632 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYDEFPEPIKLDRNDRAKPSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatccaggaagaaagtgctcttgaaagtcatcatcctgggagattccggtgttgga aagacctcccttatgaaccagtatgtgaacaagaagtttagtaaccagtacaaagctaca ataggagcagacttcctgaccaaggaggtgatggtggacgaccggctcgttacaatgcag atctgggacacagctggccaggagaggttccagtctttgggtgtggcgttctatcgtgga gcagactgctgtgtgctggtgttcgatgtgactgcacccaacaccttcaagacactcgac agctggagggatgagttcctgatccaggccagccctcgagatcctgagaacttccccttt gtggtgctcggcaacaagattgacttggagaacagacaggtaaccaccaaaagggctcaa gcttggtgtcagagtaagaacaacatcccatactttgagaccagcgccaaagaagccata aatgtagaacaggcattccagacaattgcacgcaacgccctcaaacaagagacagaggtg gagttgtatgatgaattcccagagcctataaaactggataggaatgacagagctaaacct tcagcagaaagctgcagctgctaa

DBGET integrated database retrieval system