Anoplopoma fimbria (sablefish): 129106467 Help Entry 129106467         CDS       T09102                                  Symbol cenps Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism afb  Anoplopoma fimbria (sablefish) Pathway afb03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:afb00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     129106467 (cenps)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:afb03036]     129106467 (cenps)    03400 DNA repair and recombination proteins [BR:afb03400]     129106467 (cenps) Chromosome and associated proteins [BR:afb03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      129106467 (cenps) DNA repair and recombination proteins [BR:afb03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      129106467 (cenps) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Histone TFIID-31kDa Luteo_PO Motif Other DBs NCBI-GeneID:  129106467 NCBI-ProteinID:  XP_054473847 LinkDB All DBs Position 17:17525481..17529170 Genome browser AA seq 122 aa AA seqDB search MSVGKDETEQRLKAAVHFAVGGVCQRMVEDHRRQFSRQVTAAIAETTFRQCDIFAKDLEA FARHAKRSTVSSEDVKLVARRSTALSIYIQNKSEELNQEQRELKKKNTGKRKSRDTEEES RE NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgtctgttggtaaagacgagaccgagcagaggttaaaggcagcagtccactttgctgtg ggtggcgtgtgtcagaggatggtagaggaccaccggagacagttcagccggcaggtcaca gcagcgatagcagagaccacgttcagacaatgtgatatatttgctaaagacctggaggcc tttgcaaggcatgctaaaagaagcacggtgtcttcagaagatgtaaagctcgtagcccgt cgtagtactgcattgtcgatctacatacaaaataaaagtgaagaactgaaccaggagcag agggaattgaaaaagaagaatactgggaagaggaagagcagagacactgaggaggagagc agagaataa

DBGET integrated database retrieval system