Anoplopoma fimbria (sablefish): 129108399 Help Entry 129108399         CDS       T09102                                  Name (RefSeq) metallothionein B   KO K14739   metallothionein 1/2 Organism afb  Anoplopoma fimbria (sablefish) Brite KEGG Orthology (KO) [BR:afb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:afb03019]     129108399    03029 Mitochondrial biogenesis [BR:afb03029]     129108399 Messenger RNA biogenesis [BR:afb03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      129108399 Mitochondrial biogenesis [BR:afb03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     129108399 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  129108399 NCBI-ProteinID:  XP_054476171 LinkDB All DBs Position 19:complement(10829730..10830770) Genome browser AA seq 60 aa AA seqDB search MDPCDCSKSGTCNCGGSCTCTNCSCTTCKKSCCPCCPSGCTKCASGCVCKGKTCDTSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccttgcgactgctccaaatctggaacctgcaactgtgggggatcctgcacttgc acaaattgttcctgcaccacctgcaagaagagctgctgcccatgctgcccctccggctgc accaaatgcgcctctggctgcgtgtgcaaagggaagacatgcgacaccagctgctgtcag tga

DBGET integrated database retrieval system