Anoplopoma fimbria (sablefish): 129108648 Help Entry 129108648         CDS       T09102                                  Symbol calml4b Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism afb  Anoplopoma fimbria (sablefish) Pathway afb04020   Calcium signaling pathway afb04070   Phosphatidylinositol signaling system afb04114   Oocyte meiosis afb04218   Cellular senescence afb04261   Adrenergic signaling in cardiomyocytes afb04270   Vascular smooth muscle contraction afb04371   Apelin signaling pathway afb04625   C-type lectin receptor signaling pathway afb04744   Phototransduction afb04910   Insulin signaling pathway afb04912   GnRH signaling pathway afb04916   Melanogenesis Brite KEGG Orthology (KO) [BR:afb00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     129108648 (calml4b)    04020 Calcium signaling pathway     129108648 (calml4b)    04070 Phosphatidylinositol signaling system     129108648 (calml4b)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     129108648 (calml4b)    04218 Cellular senescence     129108648 (calml4b)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129108648 (calml4b)   09152 Endocrine system    04910 Insulin signaling pathway     129108648 (calml4b)    04912 GnRH signaling pathway     129108648 (calml4b)    04916 Melanogenesis     129108648 (calml4b)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     129108648 (calml4b)    04270 Vascular smooth muscle contraction     129108648 (calml4b)   09157 Sensory system    04744 Phototransduction     129108648 (calml4b)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:afb01009]     129108648 (calml4b)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:afb04131]     129108648 (calml4b)    03036 Chromosome and associated proteins [BR:afb03036]     129108648 (calml4b)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:afb04147]     129108648 (calml4b) Protein phosphatases and associated proteins [BR:afb01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      129108648 (calml4b) Membrane trafficking [BR:afb04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     129108648 (calml4b) Chromosome and associated proteins [BR:afb03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      129108648 (calml4b) Exosome [BR:afb04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    129108648 (calml4b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_9 CFAP251_C EF-hand_8 SAPC2_N AIF-1 GPHH EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  129108648 NCBI-ProteinID:  XP_054476500 LinkDB All DBs Position 19:complement(28363666..28369932) Genome browser AA seq 164 aa AA seqDB search MSHIARGCLCLNAKFLTQDQINEFKECFSLYDRQQKGRIEARELITVMRCLGSNPTPSEV QRHLLSHSTGLGGELDFSTFLSVMHRQLQQEAPEEEILEAMRMADKEQKGFIMASELRAK LTGLGEKLTDREVDELLKEAGVGADGRVHCEQFAKAVTRCSAKR NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atgtctcacatcgcccgaggctgtctttgcctgaatgccaagttcctgactcaggatcag attaatgagttcaaggagtgtttctctctgtacgaccggcagcagaagggtaggatcgag gcccgggagttgatcacagtgatgagatgtctcgggtcgaacccgaccccctccgaggtc cagagacacctgctgagtcacagcacaggtttgggtggagagctggacttctccaccttc ctgagcgtcatgcaccggcagctccagcaggaggcgccggaggaggagatcctggaggcc atgaggatggccgacaaggagcagaagggcttcatcatggcctcggagctgagggccaaa ctcacggggctgggggagaagctgacggaccgagaggtggacgagctgctgaaggaggcg ggagttggtgctgacggacgggttcactgtgagcagtttgctaaagcggtgactcgctgc tctgcaaaacgctga

DBGET integrated database retrieval system