Anoplopoma fimbria (sablefish): 129109815 Help Entry 129109815         CDS       T09102                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism afb  Anoplopoma fimbria (sablefish) Pathway afb04382   Cornified envelope formation afb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:afb00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     129109815  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129109815  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:afb04147]     129109815 Exosome [BR:afb04147]  Exosomal proteins   Exosomal proteins of microglial cells    129109815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_6 EF-hand_1 CRISPR_Cas9_WED Motif Other DBs NCBI-GeneID:  129109815 NCBI-ProteinID:  XP_054477931 LinkDB All DBs Position 20:16126345..16127959 Genome browser AA seq 101 aa AA seqDB search MTDLENCMESLIKIFHCYADEDKDKTTLSKKELTKLIEKELPTFLKTQKNPKVVDEIKKD LDQNGDDKVDFQEFLSLVTGLSIACEKCFMLLEQKKGKKCC NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgactgacttagagaattgcatggagtctctgattaaaatattccactgctatgccgat gaagacaaagataaaacgaccttaagcaagaaagaactgaccaaactgatagagaaagag ttacccacctttctgaaaacccagaagaaccccaaagttgtggatgagatcaagaaagat ttggaccaaaacggagatgataaggtggactttcaagagtttctttccctcgtcaccggc ctctcaatagcctgtgagaagtgtttcatgctccttgaacagaagaagggcaagaagtgt tgttga

DBGET integrated database retrieval system