Anoplopoma fimbria (sablefish): 129113038 Help Entry 129113038         CDS       T09102                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism afb  Anoplopoma fimbria (sablefish) Pathway afb04145   Phagocytosis afb04517   IgSF CAM signaling afb04814   Motor proteins afb05132   Salmonella infection Brite KEGG Orthology (KO) [BR:afb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     129113038 (dynll2b)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     129113038 (dynll2b)   09142 Cell motility    04814 Motor proteins     129113038 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129113038 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:afb03037]     129113038 (dynll2b)    04812 Cytoskeleton proteins [BR:afb04812]     129113038 (dynll2b) Cilium and associated proteins [BR:afb03037]  Motile cilia and associated proteins   Dynein arm    129113038 (dynll2b) Cytoskeleton proteins [BR:afb04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      129113038 (dynll2b) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light RP853 Nop Motif Other DBs NCBI-GeneID:  129113038 NCBI-ProteinID:  XP_054481120 LinkDB All DBs Position 24 Genome browser AA seq 89 aa AA seqDB search MTEKKAVIKNADMSDEMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgactgagaagaaggcagtgataaaaaatgcagatatgtctgatgaaatgcagcaggat gcagtggactgtgccatgcaggctatggaaaagtacaacattgaaaaggacatcgcagcc tatgtcaaaaaggaatttgacaagaagtacaaccccacatggcactgcattgttgggagg aactttggaagctacgtgacacacgagacgaagcacttcatctacttctacttgggtcaa gttgcaattctactgttcaagtcaggctga

DBGET integrated database retrieval system