KEGG   Anoplopoma fimbria (sablefish): 129113445
Entry
129113445         CDS       T09102                                 
Symbol
skp1
Name
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
afb  Anoplopoma fimbria (sablefish)
Pathway
afb03083  Polycomb repressive complex
afb04110  Cell cycle
afb04114  Oocyte meiosis
afb04120  Ubiquitin mediated proteolysis
afb04141  Protein processing in endoplasmic reticulum
afb04310  Wnt signaling pathway
afb04350  TGF-beta signaling pathway
afb05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:afb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    129113445 (skp1)
   04120 Ubiquitin mediated proteolysis
    129113445 (skp1)
  09126 Chromosome
   03083 Polycomb repressive complex
    129113445 (skp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    129113445 (skp1)
   04350 TGF-beta signaling pathway
    129113445 (skp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    129113445 (skp1)
   04114 Oocyte meiosis
    129113445 (skp1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    129113445 (skp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:afb04131]
    129113445 (skp1)
   04121 Ubiquitin system [BR:afb04121]
    129113445 (skp1)
   03036 Chromosome and associated proteins [BR:afb03036]
    129113445 (skp1)
Membrane trafficking [BR:afb04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    129113445 (skp1)
Ubiquitin system [BR:afb04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     129113445 (skp1)
   Cul7 complex
     129113445 (skp1)
Chromosome and associated proteins [BR:afb03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     129113445 (skp1)
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     129113445 (skp1)
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 129113445
NCBI-ProteinID: XP_054481706
LinkDB
Position
24:complement(4228947..4234682)
AA seq 163 aa
MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgcccacaataaagctgcagagctccgatggggagatcttcgaggtggatgtggagatc
gccaaacagtctgtgaccatcaagaccatgttggaagatttgggaatggatgatgaagga
gatgatgacccagttcccctccccaatgtaaacgctgccatccttaaaaaggtgattcag
tggtgcactcatcacaaagatgaccctcctccacccgaggacgatgagaacaaggagaag
aggacggatgacattcctgtgtgggaccaggagttcctcaaagtggaccagggaaccttg
tttgaactcattctggccgccaactatttggacatcaaaggcctgttagatgtcacctgc
aagacggtggccaacatgattaaaggcaaaaccccggaggagatccggaagactttcaac
atcaaaaatgatttcacagaggaggaggaagcccaggtacgcaaagagaaccagtggtgt
gaagagaagtaa

DBGET integrated database retrieval system