Alistipes finegoldii: Alfi_0255 Help Entry Alfi_0255         CDS       T02133                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism afd  Alistipes finegoldii Pathway afd01100   Metabolic pathways afd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:afd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Alfi_0255    00074 Mycolic acid biosynthesis     Alfi_0255   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Alfi_0255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Guanylate_cyc DUF1493 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AFL76662 UniProt:  I3YI44 LinkDB All DBs Position complement(269381..269617) Genome browser AA seq 78 aa AA seqDB search MSEVQSKVVEIIVDKLGVKESEVVPEASFTNHLGADSLDTVELIMEFEKAFDIQIPDEDA EKIATVGDAINYIEEHKK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcagaagttcaatcaaaagttgtcgaaatcattgtcgacaaactgggtgttaaggag tcggaggtagtgcccgaagcaagctttaccaaccacttgggtgcagactcgctcgacacc gtggagctgatcatggaattcgagaaggctttcgatatccagattccggacgaggacgct gagaagatcgctaccgtaggtgacgcgatcaactatatcgaggagcacaagaaataa

DBGET integrated database retrieval system