Alysiella filiformis: H3L97_04175 Help Entry H3L97_04175       CDS       T06725                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aff  Alysiella filiformis Pathway aff01100   Metabolic pathways aff01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aff00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H3L97_04175 (acpP)    00074 Mycolic acid biosynthesis     H3L97_04175 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H3L97_04175 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF7080 Motif Other DBs NCBI-ProteinID:  QMT32438 LinkDB All DBs Position complement(852906..853142) Genome browser AA seq 78 aa AA seqDB search MMSIEQQVKSIVAEQLGVAIEEVKNESSFQDDLGADSLDTVELVMALEEAFGCEIPDEDA EKITTVQAAIDYVNAKQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atcatgtctattgaacaacaagtgaaaagcatcgttgccgaacagttgggcgttgccatt gaagaagtgaaaaacgaatcatctttccaagatgatttgggcgcagattctttggacacg gttgaattggttatggctttggaagaagccttcggttgcgaaatccccgatgaagacgcg gaaaaaatcaccaccgtacaagccgccattgattatgtcaacgccaaacaagcgtaa

DBGET integrated database retrieval system