Alysiella filiformis: H3L97_10110
Help
Entry
H3L97_10110 CDS
T06725
Name
(GenBank) LD-carboxypeptidase
KO
K01297
muramoyltetrapeptide carboxypeptidase [EC:
3.4.17.13
]
Organism
aff
Alysiella filiformis
Brite
KEGG Orthology (KO) [BR:
aff00001
]
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
aff01002
]
H3L97_10110
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
aff01011
]
H3L97_10110
Enzymes [BR:
aff01000
]
3. Hydrolases
3.4 Acting on peptide bonds (peptidases)
3.4.17 Metallocarboxypeptidases
3.4.17.13 muramoyltetrapeptide carboxypeptidase
H3L97_10110
Peptidases and inhibitors [BR:
aff01002
]
Serine peptidases
Family S66
H3L97_10110
Peptidoglycan biosynthesis and degradation proteins [BR:
aff01011
]
Precursor biosynthesis
Carboxypeptidase
H3L97_10110
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Peptidase_S66C
Peptidase_S66
Motif
Other DBs
NCBI-ProteinID:
QMT31060
LinkDB
All DBs
Position
2056136..2057338
Genome browser
AA seq
400 aa
AA seq
DB search
MNHLLTRRRVLQSTLIAAGSSILAACGGGNAPSKTSPNKPQMQTMPTPVPTPQTAPTRAS
HGAQNTMRLFASSGFAEDPSRIETGLSRLFQAGFVINNHTAAYRRFQRFAGSDAERIADL
QDVATGRVATPKVLMGVRGGYGAARLLPHIDWINLGARMREQQTLLFGFSDVTAIQLALL
AQGNMPSFAGPMLYSEFAKPVPDTYTMDSFIQTTTQKQSTVFVGGYQMNRVRNADGILWG
GNLSVIASLVGTPYMPKINGGILFLEDVSEQPYRIERMLQTLHLAGILKQQQAIILGDFR
MGNIRDTYDSSYDLNSVAMTISRTANVPVYTSFPFGHIAQKTTFPLGAQAQLRASNNGGY
AVTFSGYPTLNPAALNLAALKPAPAFDFTNPNGSISDSEF
NT seq
1203 nt
NT seq
+upstream
nt +downstream
nt
atgaatcatttactcacacgccgccgcgtgttacaaagcacactcattgcagcaggcagc
agcattttggcagcctgtggcggtggcaatgcccccagcaaaacttcccccaacaaaccg
caaatgcaaaccatgcccaccccagttcccacaccccaaaccgcccccactcgcgcaagc
cacggcgcacaaaacaccatgcgcctgtttgcctcatcgggatttgccgaagaccccagc
cgcattgaaacgggtttgagccgactgtttcaggcaggctttgtgattaacaaccacacg
gcagcctatcgccgttttcaacgctttgcaggcagcgatgccgaacgcattgccgatttg
caagatgtggcaacaggtcgcgttgccacccccaaagtgttgatgggcgtacgcggtggt
tatggtgcagcacgcttgttgccacacattgattggataaacttgggcgcaagaatgcgc
gaacagcaaactttattgtttggattcagcgatgtaaccgccatacaactggcattgttg
gcacaaggcaatatgcccagctttgcaggccccatgttgtacagcgaatttgccaaaccc
gtacccgacacttatacaatggacagttttatccaaaccaccacacaaaaacaaagcacc
gtgtttgtgggtggctaccaaatgaaccgcgttcgcaatgcagatggcattttgtggggc
ggcaatttgagcgtcatcgcatcgctggttggcacgccctatatgcccaaaatcaacggt
ggcattttgtttttggaagatgtgtccgaacaaccctatcgcatagaaagaatgttgcaa
accttgcatttggcaggcattttaaaacagcagcaagcgattattttgggcgatttccgc
atgggcaacatacgcgacacctacgacagcagctacgatttaaacagcgtggcaatgacg
atttcgcgcaccgccaatgtgcccgtgtacaccagctttccgtttgggcatatcgcgcaa
aaaaccacgttccccttgggcgcacaagcgcaacttcgcgccagcaacaatggcggctat
gcggtaacattcagtggctaccccacgctcaatcctgccgcgctgaatttggcggcattg
aaacccgccccagcctttgattttaccaaccccaacggcagcatttccgatagcgaattt
tga
DBGET
integrated database retrieval system