Archaeoglobus fulgidus DSM 8774: AFULGI_00017450 Help Entry AFULGI_00017450   CDS       T03231                                  Name (GenBank) Histones H3 and H4   KO K24450   DNA-binding protein Organism afg  Archaeoglobus fulgidus DSM 8774 Brite KEGG Orthology (KO) [BR:afg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:afg03036]     AFULGI_00017450 Chromosome and associated proteins [BR:afg03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     AFULGI_00017450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TFIID-31kDa CENP-T_C CENP-S Bromo_TP TFIID_20kDa TFIID-18kDa TAF LonB_AAA-LID DUF1931 AAA_lid_2 TIP49_C Motif Other DBs NCBI-ProteinID:  AIG98503 UniProt:  A0A075WLU9 LinkDB All DBs Position 1509631..1509834 Genome browser AA seq 67 aa AA seqDB search MAELPMAPVDRLIRKAGAERVSADAVEKMVEVLEDYAITVAKKAVEIAKHSGRKTVTADD IKLALSM NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggctgagttgccgatggcaccggttgacagattgattaggaaggctggggctgagaga gtaagtgcagatgcagtggaaaagatggtcgaagtgcttgaggactacgcaattaccgtt gctaagaaagctgtggaaattgcgaagcactctggcagaaagaccgtcactgcggacgac attaagctcgctctctcgatgtaa

DBGET integrated database retrieval system