Acidithiobacillus ferrianus: GL267_011600 Help Entry GL267_011600      CDS       T10957                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism afh  Acidithiobacillus ferrianus Pathway afh02024   Quorum sensing afh03018   RNA degradation Brite KEGG Orthology (KO) [BR:afh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     GL267_011600 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     GL267_011600 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:afh03019]     GL267_011600 (hfq)    03036 Chromosome and associated proteins [BR:afh03036]     GL267_011600 (hfq) Messenger RNA biogenesis [BR:afh03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      GL267_011600 (hfq) Chromosome and associated proteins [BR:afh03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     GL267_011600 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Motif Other DBs NCBI-ProteinID:  XRI68391 LinkDB All DBs Position complement(2318182..2318466) Genome browser AA seq 94 aa AA seqDB search MAGQQKGQILQDPFLNLLRKEHVPVAIYLVNGIKLQGFVESFDQFVVLLRNNVSQMIYKH AISTVVPGRDVRLPLPEGETEGVAEVKERPDSGQ NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggccggacaacaaaaaggacagatcctccaggatccctttctcaatctgttacgcaaa gagcacgtgcccgtcgcaatttatctggtgaacgggatcaagctgcaagggtttgtggaa tctttcgaccagtttgtcgtattgctgcgcaataatgtcagtcagatgatttataagcat gctatttccaccgtggtgcccggtcgtgatgtacgtttgcccttgcctgaaggggaaacc gagggcgttgcagaggtgaaggagcggcctgattctgggcaatag

DBGET integrated database retrieval system