Acidithiobacillus ferrivorans: Acife_1444 Help Entry Acife_1444        CDS       T01595                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism afi  Acidithiobacillus ferrivorans Pathway afi01100   Metabolic pathways afi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:afi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Acife_1444    00074 Mycolic acid biosynthesis     Acife_1444   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Acife_1444 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Motif Other DBs NCBI-ProteinID:  AEM47594 UniProt:  G0JRK1 LinkDB All DBs Position 1459049..1459297 Genome browser AA seq 82 aa AA seqDB search MDSVAERVKKVVVEQLGVNEDEVTNEASFVDDLGADSLDTVELVMALEEEFDCEIPDEEA EKIATVQQAIDYVSAHMPAKDA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggatagtgtggcagaacgtgtaaagaaggtcgtagtagagcagttgggcgtcaacgaa gatgaagtaaccaatgaagcctcttttgtcgatgatctgggcgctgactcgctggatacc gtggaactggtgatggcgctagaagaagaatttgattgcgaaatccccgacgaagaagca gagaagattgcgactgtgcaacaggccattgattatgtgtctgcgcatatgccagccaag gatgcctga

DBGET integrated database retrieval system