Amphiura filiformis: 140159068 Help Entry 140159068         CDS       T10871                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism afil  Amphiura filiformis Pathway afil04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:afil00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     140159068  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:afil04121]     140159068    03400 DNA repair and recombination proteins [BR:afil03400]     140159068 Ubiquitin system [BR:afil04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      140159068    Cul5 complex      140159068 DNA repair and recombination proteins [BR:afil03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      140159068 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Rad60-SLD_2 Motif Other DBs NCBI-GeneID:  140159068 NCBI-ProteinID:  XP_072038502 LinkDB All DBs Position 1 Genome browser AA seq 122 aa AA seqDB search MDVFLMIRRQKTTIFTDAKESSTVYELKKIIEGITKKSPEEQQLFKDGEILENTKTLGDC GLSANVAKAQAPASLGLSFRVNVDTDEFEPLEMTPYSNPPELPDVMKPTDSSTTNTVEQP VS NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggatgtatttctaatgataagaagacaaaagaccaccatcttcacagatgcaaaagag tccagcactgtgtacgagctcaaaaagatcatagaagggataaccaagaaatcaccagaa gagcaacaacttttcaaagatggcgagattttagaaaacaccaagacgttaggagattgt gggctgagtgcaaatgtagccaaagcccaggctccagcatcactaggtttatccttcaga gtaaatgtggatactgatgaatttgagccattggaaatgacaccttactctaatcctcca gagttgccagatgtaatgaagccaacagattctagcacaacaaatacagtagaacagcca gtgtcatag

DBGET integrated database retrieval system