Amphiura filiformis: 140170507 Help Entry 140170507         CDS       T10871                                  Name (RefSeq) rho-related protein racG-like   KO K04393   cell division control protein 42 Organism afil  Amphiura filiformis Pathway afil04144   Endocytosis afil05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:afil00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     140170507  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     140170507  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:afil04131]     140170507    03036 Chromosome and associated proteins [BR:afil03036]     140170507   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:afil04147]     140170507    04031 GTP-binding proteins [BR:afil04031]     140170507 Membrane trafficking [BR:afil04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     140170507  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     140170507   Macropinocytosis    Ras GTPases     140170507 Chromosome and associated proteins [BR:afil03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     140170507 Exosome [BR:afil04147]  Exosomal proteins   Exosomal proteins of microglial cells    140170507   Exosomal proteins of breast milk    140170507 GTP-binding proteins [BR:afil04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     140170507 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Motif Other DBs NCBI-GeneID:  140170507 NCBI-ProteinID:  XP_072049964 LinkDB All DBs Position 14:64304330..64322036 Genome browser AA seq 145 aa AA seqDB search MTCQEDYDRLRPLSYPLTDVFLVCFSVVQPASFENVSAKWIPEITSHNPNTPYLLVAMKI DLRDNKEEIKRLLRDGIKYHRNIKEPISTPKGELLANKIGAAKYVECSALTRVLYLYSIL LSFARADEGIFLPLNIRPNSSVSVI NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgacatgtcaggaagactatgatcgtcttcgaccactgagttatcccctgacagatgta ttcttggtgtgcttctcagttgttcaacccgcgagtttcgagaatgtatctgcaaagtgg ataccggaaattacttctcataacccgaacacaccttacctgttggttgctatgaagata gaccttagagataacaaagaggagataaaacgattgctgagagatggcattaaatatcat cggaatatcaaggagccaatatcaacacctaaaggggaactactagctaacaagatagga gcagctaaatatgttgaatgttctgctcttacaagggtattgtatttatattccatttta ctaagttttgcaagggccgatgaagggatctttctgcccttgaatatcagaccaaatagc tcggttagtgtaatttga

DBGET integrated database retrieval system