KEGG   Acidithiobacillus ferridurans: AFERRID_08440
Entry
AFERRID_08440     CDS       T05847                                 
Name
(GenBank) ABC transporter ATP-binding protein uup
  KO
K15738  ABC transport system ATP-binding/permease protein
Organism
afj  Acidithiobacillus ferridurans
Brite
KEGG Orthology (KO) [BR:afj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:afj02000]
    AFERRID_08440
Transporters [BR:afj02000]
 ABC transporters, eukaryotic type
  Other subfamilies
   Other ABC transporters
    AFERRID_08440
SSDB
Motif
Pfam: ABC_tran ABC_tran_CTD AAA_21 SMC_N ABC_tran_Xtn AAA_29 AAA_30 AAA_23 MMR_HSR1 AAA_16 AAA_22 ATP-synt_ab NACHT AAA_15 RsgA_GTPase DO-GTPase2 TsaE nSTAND3 AAA Avl9 DLIC MobB Zeta_toxin AAA_14 cobW
Other DBs
NCBI-ProteinID: BBF64626
UniProt: A0A2Z6IGV3
LinkDB
Position
821089..822951
AA seq 620 aa
MSILRLEAGQVEWGGRALLDHAELNLEAGERVGLIGRNGEGKSTLLQVLAGLCPLDGGTL
WVAPGIRRAYLAQEPELAGEHDLLTAIKSGHPAWRHLQNADADDAHAHALADHHDAWQID
YKAEALRDSLGLPAEGVVSALSGGQRKRVAIAATLVAEPDLLFLDEPTNHLDLPAILALE
QSLLRHRGTLVFVTHDRRFLDRLATRIVELDRGILRSFPGTFAAYQSRKAEVLAAEAAAD
SRLEGQLAEEEAWLRQGVKARAKRNQGRLRRLEGLREERASRRQQQGHATLQISTADRSG
ALIAELDHVSFAYGGRPVIRDFSTRIERGDRVGIIGPNGAGKTTLLRLILGELEPQEGTV
RRGTKQEVAYFDQMRATLDPESRVLDAIADGNDFIDINGERRHVLSYLQDFLFPPSRARG
LIKALSGGERARLLLARLFARPANILVLDEPTNDLDLETLEVLEERLQSYAGTIFLVSHD
RDFLDNVVTQVIAFGEDGQISQNAGGYEDWLRWQMESQRTAKSVEGGGGKGSGKRDGGKG
RKSAMSYKENQELAALPAQIEALEKEEGEIAATLALPETYQNPERLREVQARADVVSASL
TKAYGRWEALEEKAARAADF
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgtctattctgcggctggaggcagggcaagtggaatggggtggccgggcgctgctggac
catgccgagttgaatctggaggcgggcgagcgggtcggcctgatcggccgcaacggtgaa
ggcaagtctaccctgctgcaagtgctggcagggctctgccccctcgatggtggaacgctg
tgggtggcgcccggcatacgtcgggcctacctggcgcaggagccggaattagccggtgag
cacgacctgctcaccgccatcaaatccggacatcctgcctggcggcacttgcagaatgcc
gatgcggacgatgcccatgcccatgcccttgccgaccaccacgatgcctggcagatcgac
tacaaggcagaggccctgcgcgacagcctggggctgcccgctgaaggcgtggtcagcgcc
ctttccggcggccagcgcaagcgggtagccatcgccgccaccctggtcgccgagccggac
ctgctctttctcgacgaacccaccaaccatctcgacctgcccgccatcctggcgctggaa
caatccctgctgcgccatcgcggcacactggtcttcgtcacccacgatcgacgttttctc
gaccgcctggcgacccgcatcgtcgaactggatcgtggcatactacgcagttttccgggc
acttttgcggcttatcaaagccgcaaggccgaagtcctcgctgctgaggctgccgccgac
agccgtctggaagggcaactggcggaagaggaggcctggctgcgccagggggtcaaggcc
cgcgccaagcgcaaccagggccgcctgcgccgtctggaggggctgcgtgaggagcgcgcc
agccgtcgtcagcagcaggggcacgccaccctgcaaatcagcacggcggatcgttccggc
gcactcattgccgagctggatcacgtgtcttttgcctatggtgggcgtccggtcatccgc
gatttttccacccgcatcgaacgcggcgaccgggttggcattatcggccccaatggagcg
ggcaagacgacactgctgcgcctgatccttggcgaactggagccacaggagggtaccgtc
cgccgcggcaccaaacaggaggtcgcctacttcgaccagatgcgcgccaccctcgacccc
gagagccgggtgttggacgccatcgcggacgggaatgattttatcgacatcaatggcgaa
cgccgtcacgtgctgagctatctgcaggatttcctcttcccgcccagccgggcgcggggg
ctgatcaaggcactctccggcggcgagcgcgcacgtttgctgctggctcgcctgtttgcc
cgccccgccaatattctggtgctggacgaacccaccaacgacctggacctggagacgctg
gaggtgctcgaagaacgtttacagagttacgccggcacgatcttcctggtatcccatgac
cgagactttctcgataacgtggtcacccaggtgatcgccttcggggaagacggccagatc
agccagaatgcgggcggctacgaggactggctgcgttggcagatggagtcgcagcgcacg
gcaaaatcggtagaaggtggcggcggcaagggttccggcaagcgggatggcggcaagggc
agaaaatccgccatgagctacaaggaaaaccaggaactcgccgccctgccggcgcagatc
gaggcgctggagaaagaagagggtgaaatcgccgccacgctggccctgccggaaacctac
cagaacccggagcgcttgcgcgaggtgcaggcccgcgccgatgtcgtcagtgcatcttta
acgaaagcgtatgggcgctgggaggcgctggaagaaaaggccgcccgggctgccgacttt
tag

DBGET integrated database retrieval system