Acidithiobacillus ferridurans: AFERRID_15980 Help Entry AFERRID_15980     CDS       T05847                                  Name (GenBank) ATP synthase subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism afj  Acidithiobacillus ferridurans Pathway afj00190   Oxidative phosphorylation afj01100   Metabolic pathways Module afj_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:afj00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AFERRID_15980  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:afj00194]     AFERRID_15980 Photosynthesis proteins [BR:afj00194]  Photosystem and electron transport system   F-type ATPase [OT]    AFERRID_15980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF6325 Motif Other DBs NCBI-ProteinID:  BBF65380 UniProt:  A0A2Z6II52 LinkDB All DBs Position 1531681..1531935 Genome browser AA seq 84 aa AA seqDB search MDAHTIIVAATAIAVGIIFGAAGLGSAIGWGLITSKTIEGITRQPEMRPQLLVNTFIFAG LMESFPFIILAFGFWFLFANPFLG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggacgcacataccatcattgttgctgctactgccattgccgtaggtatcattttcggc gccgccggtctgggttccgccatcggttggggtctgatcacctccaagactattgaaggt atcacccgtcagccggaaatgcgcccacagttgttggtgaatactttcatctttgccggt ctgatggaatctttccccttcattattctggccttcggtttctggttcctcttcgccaac ccgttcctgggctga

DBGET integrated database retrieval system