Acidithiobacillus ferridurans: AFERRID_26170 Help Entry AFERRID_26170     CDS       T05847                                  Name (GenBank) DNA-binding protein HRm   KO K03530   DNA-binding protein HU-beta Organism afj  Acidithiobacillus ferridurans Brite KEGG Orthology (KO) [BR:afj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:afj03032]     AFERRID_26170    03036 Chromosome and associated proteins [BR:afj03036]     AFERRID_26170    03400 DNA repair and recombination proteins [BR:afj03400]     AFERRID_26170 DNA replication proteins [BR:afj03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AFERRID_26170 Chromosome and associated proteins [BR:afj03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AFERRID_26170 DNA repair and recombination proteins [BR:afj03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AFERRID_26170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta Motif Other DBs NCBI-ProteinID:  BBF66399 UniProt:  A0A2Z6ILM4 LinkDB All DBs Position 2532968..2533243 Genome browser AA seq 91 aa AA seqDB search MNKTEFVAALARHGEISKVDAEKLFQVFRHTLETELPTAGKIILPGFLTLEVVEKPARKG RNPATGQELDIPAKKSIKIKAGKEFADKVNH NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaataaaacagaatttgttgcggcgctggcccgccacggtgaaatatccaaagtagac gctgaaaaattgtttcaggtgtttcgacataccctggaaactgaattaccaaccgccgga aagattatcctgccgggattcctcaccctggaggtcgtagagaagcccgcaagaaaggga cgcaatcccgccacgggtcaggaactggatatccctgccaagaaaagcatcaagatcaag gcgggcaaagagtttgcagacaaggtcaaccactaa

DBGET integrated database retrieval system