Antarcticibacterium flavum: FHG64_01005 Help Entry FHG64_01005       CDS       T06005                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism afla  Antarcticibacterium flavum Pathway afla01100   Metabolic pathways afla01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:afla00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FHG64_01005    00074 Mycolic acid biosynthesis     FHG64_01005   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FHG64_01005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Spectrin_Dys-1 Motif Other DBs NCBI-ProteinID:  QCY68089 UniProt:  A0A5B7WY89 LinkDB All DBs Position 221021..221278 Genome browser AA seq 85 aa AA seqDB search MSDLRTQLKQSIIEQLNLEEMEVDEIENDEPLFGDGLGLDSIDALELIVLLEKDYGIKLN DPAKGKEIFASINKMAEYIEAHRTK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagtgatttacgaacacagttaaagcaaagtattattgaacaactaaatcttgaagag atggaggttgatgaaatagagaatgatgaaccgctctttggagatggccttggcctggat tctattgatgcattggaattaatagtactattggaaaaggattatggaattaagcttaat gatcctgcaaagggaaaggagatttttgcttctataaataaaatggcagaatacatcgaa gctcaccgtacaaaataa

DBGET integrated database retrieval system