Alteriqipengyuania flavescens: QQW98_13290 Help Entry QQW98_13290       CDS       T09518                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aflv  Alteriqipengyuania flavescens Pathway aflv01100   Metabolic pathways aflv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aflv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QQW98_13290    00074 Mycolic acid biosynthesis     QQW98_13290   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QQW98_13290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N DUF1493 TerB_C DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WJY18567 LinkDB All DBs Position complement(2608842..2609078) Genome browser AA seq 78 aa AA seqDB search MSDTADRVQKIVVEHLGVEADKVTQDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVGDATKYIEEHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgcagaccgcgtgcagaagattgtcgtcgagcatctcggcgttgaagcc gacaaggtgacgcaggacgccagcttcatcgacgatctgggtgccgacagcctcgacatc gtcgaactggtcatggcgttcgaagaagaattcggcgtcgaaatccccgacgatgcggcg gaaaagatcgccaccgtcggcgatgccacgaagtacatcgaagaacacaagggctga

DBGET integrated database retrieval system