Aspergillus fumigatus: AFUA_5G06060 Help Entry AFUA_5G06060      CDS       T01017                                  Name (RefSeq) sulfur metabolism regulator SkpA   KO K03094   S-phase kinase-associated protein 1 Organism afm  Aspergillus fumigatus Pathway afm03083   Polycomb repressive complex afm04111   Cell cycle - yeast afm04120   Ubiquitin mediated proteolysis afm04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:afm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     AFUA_5G06060    04120 Ubiquitin mediated proteolysis     AFUA_5G06060   09126 Chromosome    03083 Polycomb repressive complex     AFUA_5G06060  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     AFUA_5G06060  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:afm04131]     AFUA_5G06060    04121 Ubiquitin system [BR:afm04121]     AFUA_5G06060    03036 Chromosome and associated proteins [BR:afm03036]     AFUA_5G06060 Membrane trafficking [BR:afm04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     AFUA_5G06060 Ubiquitin system [BR:afm04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      AFUA_5G06060    Cul7 complex      AFUA_5G06060 Chromosome and associated proteins [BR:afm03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      AFUA_5G06060   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      AFUA_5G06060 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  3511133 NCBI-ProteinID:  XP_754026 UniProt:  Q4WTT8 LinkDB All DBs Position 5:1441529..>1442525 Genome browser AA seq 158 aa AA seqDB search MTTVTLTSSDGVDITVDRDVAERSILIKNMLEDLGESDEAIPIPNVNEVVLKKVIEWCTH HKNDPPSTGDDDDSRRKTTDIDEWDQKFMQVDQEMLFEIILAANYLDIKALLDVGCKTVA NMIKGKSPEEIRKTFNIQNDFTPEEEDQIRRENEWAEE NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atgactactgttactctcacaagctccgatggcgttgacattacggtcgaccgcgatgtt gccgaacgatcgattcttatcaagaacatgctggaagatttgggcgaatcggacgaggct attcctattccaaatgtcaacgaggtggtgctgaagaaggtcattgaatggtgcactcat cacaagaacgaccctcctagcaccggtgacgacgatgactctcgccgcaagactaccgat atcgatgaatgggatcagaagttcatgcaggtcgaccaggagatgttgtttgaaattatc ttggctgccaactatctcgatatcaaagctctcttggatgtcggctgcaagactgttgcg aacatgatcaagggcaagtcccccgaagagattcgcaagaccttcaacattcagaacgat ttcactcccgaggaggaggatcaaatccgccgtgagaacgagtgggccgaggagtaa

DBGET integrated database retrieval system