Aptenodytes forsteri (emperor penguin): 103894469 Help Entry 103894469         CDS       T08527                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism afor  Aptenodytes forsteri (emperor penguin) Pathway afor04810   Regulation of actin cytoskeleton afor05132   Salmonella infection Brite KEGG Orthology (KO) [BR:afor00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103894469 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103894469 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:afor04131]     103894469 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:afor04812]     103894469 (PFN4)    04147 Exosome [BR:afor04147]     103894469 (PFN4) Membrane trafficking [BR:afor04131]  Others   Actin-binding proteins    Others     103894469 (PFN4) Cytoskeleton proteins [BR:afor04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      103894469 (PFN4) Exosome [BR:afor04147]  Exosomal proteins   Proteins found in most exosomes    103894469 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  103894469 NCBI-ProteinID:  XP_009272142 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MNQLQALLNDSLIRTKHVENAAIIDIRERKVCASTFGFNVPPENALNLIYTSFKNLVQVR RGGLYFKEKHYKCVRADEHSIYLRNPDGGLIVVKTKTFILVATYRVGMYPSVCVEAVEKL ADYFREKGS NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgaaccaactgcaggctttgctgaatgacagtcttatcagaacaaagcacgtggaaaac gcagctatcatcgacataagggaaagaaaagtctgtgcatcaacctttggctttaatgtg ccaccagagaatgctttaaaccttatctacacttccttcaagaacttagtgcaagttaga aggggaggactctacttcaaggagaagcactataaatgtgtccgtgcagatgagcattcc atctaccttcgaaacccagatggaggcctgatagttgtgaagacaaaaactttcatcctg gttgctacttacagagtgggcatgtatcccagtgtgtgcgtggaagctgtggagaaacta gcagactactttagagagaaaggtagctga

DBGET integrated database retrieval system