Aptenodytes forsteri (emperor penguin): 103898927 Help Entry 103898927         CDS       T08527                                  Symbol FGF5 Name (RefSeq) fibroblast growth factor 5   KO K04358   fibroblast growth factor Organism afor  Aptenodytes forsteri (emperor penguin) Pathway afor04010   MAPK signaling pathway afor04020   Calcium signaling pathway afor04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:afor00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103898927 (FGF5)    04020 Calcium signaling pathway     103898927 (FGF5)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103898927 (FGF5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:afor04052]     103898927 (FGF5)    00536 Glycosaminoglycan binding proteins [BR:afor00536]     103898927 (FGF5) Cytokines and neuropeptides [BR:afor04052]  Cytokines   Growth factors (RTK binding)    103898927 (FGF5) Glycosaminoglycan binding proteins [BR:afor00536]  Heparan sulfate / Heparin   Growth factors/receptors    103898927 (FGF5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  103898927 NCBI-ProteinID:  XP_009277587 LinkDB All DBs Position Unknown AA seq 125 aa AA seqDB search MSKKGKLHASARFTADCQFRERFQENSYNTYASAVHRSPRSGRQWYVALNKRGKAKRGCS PHARPQHHVSTHFLPRFRQPQPPELAVTVTLPEKKPPPPPKPKVAPSPPRKNPSPVKYRL KFRFG NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaaaaaggaaaactccatgcaagtgcccggttcacggcagactgccagtttcgg gagcgcttccaggagaacagctacaacacctatgcctcggccgtccaccgcagcccgcgc tcgggccgccagtggtatgtggcgctcaacaagcggggcaaagccaagcggggctgcagc ccccatgcccggccccagcaccacgtctccacgcacttcctcccccgctttcgacagccc cagccccccgagctcgccgtcaccgtcaccctccccgaaaagaagcccccgccgccaccg aaaccaaaggtcgctccgtccccgcctcggaaaaatcccagccccgtcaagtaccggctg aagtttcgcttcgggtag

DBGET integrated database retrieval system